PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 257aa    MW: 29828.4 Da    PI: 9.7824
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597029.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.6e-143479147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g W + Ed++l+++v+q+G+ +W+ I + +  gRt+ +c+ rw + 
   XP_013597029.1 34 KGLWKPFEDDKLKQLVEQYGPQNWNIIGELFS-GRTGQSCRQRWCNQ 79
                     57799***************************.***********985 PP

2Myb_DNA-binding59.57.3e-1986129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+e+l++a++ +G++ W+ Ia+ ++ gRt++ +k++++ 
   XP_013597029.1  86 KGPFTKEEEERLLEAHRIHGNR-WAYIAKLFP-GRTDNALKNHYHV 129
                      79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3612980IPR017930Myb domain
SuperFamilySSF466896.36E-2931127IPR009057Homeodomain-like
SMARTSM007172.1E-113382IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-243587IPR009057Homeodomain-like
PfamPF139211.2E-173797No hitNo description
CDDcd001672.28E-103778No hitNo description
PROSITE profilePS5129426.03881135IPR017930Myb domain
SMARTSM007179.7E-1685133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2288134IPR009057Homeodomain-like
CDDcd001671.13E-1188128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MFDVFKKVEM ELVTTEMSRG SNSCDNKKTK GHRKGLWKPF EDDKLKQLVE QYGPQNWNII  60
GELFSGRTGQ SCRQRWCNQL APNINKGPFT KEEEERLLEA HRIHGNRWAY IAKLFPGRTD  120
NALKNHYHVT MKRRKRIGLS STPTSPFNQI RTPIFPLPRQ SDYLYPFQRY QMHNSRGPWP  180
YTSASAPRSD QFGSSWISNA QQETDLYRRK SNQMLDHQAA TPDHEKNSSG EDGTSMIDHG  240
EKRDVPFFDF LGVGLDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32341347107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597029.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0D3DHG80.0A0A0D3DHG8_BRAOL; Uncharacterized protein
STRINGBra037004.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101332036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33450.19e-96myb domain protein 69